PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00866.1.p
Common NameEUGRSUZ_B00866, LOC104422141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 196aa    MW: 21931.1 Da    PI: 10.5263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00866.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.8e-191360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W+++Ed++l+d+v+++G g+W++ ++  g+ R++k+c++rw++yl
  Eucgr.B00866.1.p 13 KGAWSEQEDQKLIDYVQKHGEGNWNSLPKAAGLLRCGKSCRLRWLNYL 60
                      79******************************99************97 PP

2Myb_DNA-binding53.74.7e-1766111148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.B00866.1.p  66 RGNFGEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24462IPR009057Homeodomain-like
PROSITE profilePS5129416.617860IPR017930Myb domain
SuperFamilySSF466894.67E-3011107IPR009057Homeodomain-like
SMARTSM007177.2E-151262IPR001005SANT/Myb domain
PfamPF002494.4E-181360IPR001005SANT/Myb domain
CDDcd001679.51E-121560No hitNo description
PROSITE profilePS5129426.24661115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2563115IPR009057Homeodomain-like
SMARTSM007174.2E-1665113IPR001005SANT/Myb domain
PfamPF002499.9E-1666111IPR001005SANT/Myb domain
CDDcd001675.11E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MRNPCCDKQK TNKGAWSEQE DQKLIDYVQK HGEGNWNSLP KAAGLLRCGK SCRLRWLNYL  60
RPDLKRGNFG EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLLSKGI  120
IHRRPSAAKI KSSTEDKTVH QSSAAISIKE KGVSPDGDRL DLKLGVSGGP AKHSKHAQSK  180
EINGGKPYTT LLLFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-301211526128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00866.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032684.11e-142PREDICTED: myb-related protein 308-like
SwissprotP813937e-73MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A059CZV31e-142A0A059CZV3_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s12420.12e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.15e-73myb domain protein 6